- Improves the build system to install the submission scripts in bin - Add README
61 lines
1.5 KiB
Markdown
61 lines
1.5 KiB
Markdown
# Alphafold
|
|
|
|
Alphafold contains two parts:
|
|
1. A conda environment containing dependencies
|
|
2. The alphafold module itself, containing the current code and submission scripts.
|
|
|
|
## Conda Environment
|
|
|
|
Alphafold was installed based on Dima's instructions on ra
|
|
(`/das/work/common/opt/alphafold/2021-07/INSTALL`).
|
|
|
|
On pmod6 as an admin user:
|
|
|
|
```
|
|
conda create --name alphafold python==3.8
|
|
conda update -n base conda
|
|
|
|
source miniconda3/etc/profile.d/conda.sh
|
|
conda activate alphafold
|
|
|
|
conda install -y -c conda-forge openmm==7.5.1 cudnn==8.2.1.32 cudatoolkit==11.0.3 pdbfixer==1.7
|
|
conda install -y -c bioconda hmmer==3.3.2 hhsuite==3.3.0 kalign2==2.04
|
|
|
|
pip install absl-py==0.13.0 biopython==1.79 chex==0.0.7 dm-haiku==0.0.4 \
|
|
dm-tree==0.1.6 immutabledict==2.0.0 jax==0.2.14 ml-collections==0.1.0 \
|
|
numpy==1.19.5 scipy==1.7.0 tensorflow==2.5.0
|
|
pip install --upgrade jax jaxlib==0.1.69+cuda111 \
|
|
-f https://storage.googleapis.com/jax-releases/jax_releases.html
|
|
```
|
|
|
|
If this needs to be updated in the future we may need to have versioned conda envs.
|
|
|
|
## Alphafold module
|
|
|
|
Add version to files/variants. The version number should match a github tag
|
|
(e.g. `v2.0.1`) or else have the commit hash as `$V_RELEASE`.
|
|
|
|
As admin user:
|
|
```
|
|
cd MX/alphafold
|
|
./build <version>
|
|
```
|
|
|
|
## Testing
|
|
|
|
Here's an example sequence:
|
|
|
|
```
|
|
mkdir example
|
|
cd example
|
|
cat > query.fasta <<EOF
|
|
>dummy_sequence
|
|
GWSTELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE
|
|
EOF
|
|
|
|
module use MX unstable
|
|
module load alphafold/2.0.1
|
|
sbatch $ALPHAFOLD_DIR/bin/submit_merlin.sh query.fasta
|
|
```
|
|
|