Release Alphafold 2.0.1
- Improves the build system to install the submission scripts in bin - Add README
This commit is contained in:
60
MX/alphafold/README.md
Normal file
60
MX/alphafold/README.md
Normal file
@@ -0,0 +1,60 @@
|
||||
# Alphafold
|
||||
|
||||
Alphafold contains two parts:
|
||||
1. A conda environment containing dependencies
|
||||
2. The alphafold module itself, containing the current code and submission scripts.
|
||||
|
||||
## Conda Environment
|
||||
|
||||
Alphafold was installed based on Dima's instructions on ra
|
||||
(`/das/work/common/opt/alphafold/2021-07/INSTALL`).
|
||||
|
||||
On pmod6 as an admin user:
|
||||
|
||||
```
|
||||
conda create --name alphafold python==3.8
|
||||
conda update -n base conda
|
||||
|
||||
source miniconda3/etc/profile.d/conda.sh
|
||||
conda activate alphafold
|
||||
|
||||
conda install -y -c conda-forge openmm==7.5.1 cudnn==8.2.1.32 cudatoolkit==11.0.3 pdbfixer==1.7
|
||||
conda install -y -c bioconda hmmer==3.3.2 hhsuite==3.3.0 kalign2==2.04
|
||||
|
||||
pip install absl-py==0.13.0 biopython==1.79 chex==0.0.7 dm-haiku==0.0.4 \
|
||||
dm-tree==0.1.6 immutabledict==2.0.0 jax==0.2.14 ml-collections==0.1.0 \
|
||||
numpy==1.19.5 scipy==1.7.0 tensorflow==2.5.0
|
||||
pip install --upgrade jax jaxlib==0.1.69+cuda111 \
|
||||
-f https://storage.googleapis.com/jax-releases/jax_releases.html
|
||||
```
|
||||
|
||||
If this needs to be updated in the future we may need to have versioned conda envs.
|
||||
|
||||
## Alphafold module
|
||||
|
||||
Add version to files/variants. The version number should match a github tag
|
||||
(e.g. `v2.0.1`) or else have the commit hash as `$V_RELEASE`.
|
||||
|
||||
As admin user:
|
||||
```
|
||||
cd MX/alphafold
|
||||
./build <version>
|
||||
```
|
||||
|
||||
## Testing
|
||||
|
||||
Here's an example sequence:
|
||||
|
||||
```
|
||||
mkdir example
|
||||
cd example
|
||||
cat > query.fasta <<EOF
|
||||
>dummy_sequence
|
||||
GWSTELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE
|
||||
EOF
|
||||
|
||||
module use MX unstable
|
||||
module load alphafold/2.0.1
|
||||
sbatch $ALPHAFOLD_DIR/bin/submit_merlin.sh query.fasta
|
||||
```
|
||||
|
||||
@@ -49,7 +49,7 @@ hostname >> "$LOG"
|
||||
set +u # Allow unset variables in activate commands
|
||||
module purge
|
||||
module use MX unstable
|
||||
module load anaconda/2019.07 cuda/11.0.3 alphafold/2.0.0-b88f8da 2>> "$LOG"
|
||||
module load alphafold/ALPHAFOLD_VERSION 2>> "$LOG"
|
||||
conda activate "${ALPHAFOLD_ENV:?"Error: ALPHAFOLD_ENV not set. Try 'module use MX unstable; module load alphafold'"}"
|
||||
set -u
|
||||
|
||||
|
||||
@@ -18,6 +18,6 @@
|
||||
export ALPHAFOLD_DATA=/data/project/bio/shared/alphafold
|
||||
module purge
|
||||
module use MX unstable
|
||||
module load anaconda/2019.07 cuda/11.0.3 alphafold/2.0.0-b88f8da
|
||||
module load alphafold/ALPHAFOLD_VERSION
|
||||
|
||||
exec "${ALPHAFOLD_DIR:?Error loading module}/bin/submit.sh" "$@"
|
||||
|
||||
@@ -24,7 +24,7 @@ module --version
|
||||
|
||||
module purge
|
||||
module use MX unstable Programming
|
||||
module load anaconda/2019.07 cuda/11.0.3 alphafold/2.0.0-b88f8da
|
||||
module load alphafold/ALPHAFOLD_VERSION
|
||||
module list
|
||||
|
||||
exec "${ALPHAFOLD_DIR:?Error loading module}/bin/submit.sh" "$@"
|
||||
|
||||
@@ -29,9 +29,14 @@ pbuild::install() {
|
||||
git clone --depth=1 -b "$BRANCH" https://github.com/deepmind/alphafold.git "$ALPHAFOLD_HOME" || return $?
|
||||
if ! [ -f "$ALPHAFOLD_HOME/alphafold/common/stereo_chemical_props.txt" ]; then
|
||||
wget -q -P "$ALPHAFOLD_HOME/alphafold/common/" \
|
||||
--no-check-certificate `# wget root certs are old` \
|
||||
https://git.scicore.unibas.ch/schwede/openstructure/-/raw/7102c63615b64735c4941278d92b554ec94415f8/modules/mol/alg/src/stereo_chemical_props.txt
|
||||
fi
|
||||
wget -O "$ALPHAFOLD_HOME/run_alphafold.sh" \
|
||||
https://raw.githubusercontent.com/kalininalab/alphafold_non_docker/main/run_alphafold.sh
|
||||
chmod +x "$ALPHAFOLD_HOME/run_alphafold.sh"
|
||||
|
||||
cp -r "$BUILDBLOCK_DIR/bin" "$PREFIX/"
|
||||
sed -i "s/ALPHAFOLD_VERSION/$V/g" "$PREFIX/bin/"*
|
||||
}
|
||||
|
||||
|
||||
@@ -1 +1,2 @@
|
||||
alphafold/2.0.0-b88f8da anaconda/2019.07 b:gcc/10.3.0 cuda/11.0.3
|
||||
alphafold/2.0.0-b88f8da unstable anaconda/2019.07 b:gcc/10.3.0 cuda/11.0.3
|
||||
alphafold/2.0.1 unstable anaconda/2019.07 b:gcc/10.3.0 cuda/11.0.3
|
||||
|
||||
@@ -0,0 +1,2 @@
|
||||
The alphafold environment is a complex mixture of conda and pip. See
|
||||
MX/alphafold/README.md.
|
||||
Reference in New Issue
Block a user