5233ffd6e6
- Improves the build system to install the submission scripts in bin - Add README
Alphafold
Alphafold contains two parts:
- A conda environment containing dependencies
- The alphafold module itself, containing the current code and submission scripts.
Conda Environment
Alphafold was installed based on Dima's instructions on ra
(/das/work/common/opt/alphafold/2021-07/INSTALL).
On pmod6 as an admin user:
conda create --name alphafold python==3.8
conda update -n base conda
source miniconda3/etc/profile.d/conda.sh
conda activate alphafold
conda install -y -c conda-forge openmm==7.5.1 cudnn==8.2.1.32 cudatoolkit==11.0.3 pdbfixer==1.7
conda install -y -c bioconda hmmer==3.3.2 hhsuite==3.3.0 kalign2==2.04
pip install absl-py==0.13.0 biopython==1.79 chex==0.0.7 dm-haiku==0.0.4 \
dm-tree==0.1.6 immutabledict==2.0.0 jax==0.2.14 ml-collections==0.1.0 \
numpy==1.19.5 scipy==1.7.0 tensorflow==2.5.0
pip install --upgrade jax jaxlib==0.1.69+cuda111 \
-f https://storage.googleapis.com/jax-releases/jax_releases.html
If this needs to be updated in the future we may need to have versioned conda envs.
Alphafold module
Add version to files/variants. The version number should match a github tag
(e.g. v2.0.1) or else have the commit hash as $V_RELEASE.
As admin user:
cd MX/alphafold
./build <version>
Testing
Here's an example sequence:
mkdir example
cd example
cat > query.fasta <<EOF
>dummy_sequence
GWSTELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE
EOF
module use MX unstable
module load alphafold/2.0.1
sbatch $ALPHAFOLD_DIR/bin/submit_merlin.sh query.fasta